Structure of PDB 7jps Chain B Binding Site BS02

Receptor Information
>7jps Chain B (length=199) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DQQTLRNLLSKVSPSFSAELKQLNQQYEKLFHKWMLQLHLGFNIVLYGLG
SKRDLLERFRTTMLQDSIHVVINGFFPGISVKSVLNSITEEVLDHMGTFR
SILDQLDWIVNKFKEDSSLELFLLIHNLDSQMLRGEKSQQIIGQLSSLHN
IYLIASIDHLNAPLMWDHAKQSLFNWLWYETTTYSPYTEETSYENSLLV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7jps The dynamic nature of the human Origin Recognition Complex revealed through five cryoEM structures.
Resolution4.4 Å
Binding residue
(original residue number in PDB)		K349 R367 S368 I369
Binding residue
(residue number reindexed from 1)		K82 R100 S101 I102
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003688 DNA replication origin binding
GO:0005515 protein binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006260 DNA replication
GO:0006270 DNA replication initiation
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000785 chromatin
GO:0000792 heterochromatin
GO:0000808 origin recognition complex
GO:0000939 inner kinetochore
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005664 nuclear origin of replication recognition complex
GO:0005813 centrosome
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7jps, PDBe:7jps, PDBj:7jps
PDBsum7jps
PubMed32808929
UniProtQ13416|ORC2_HUMAN Origin recognition complex subunit 2 (Gene Name=ORC2)

[Back to BioLiP]