Structure of PDB 7f9h Chain B Binding Site BS02

Receptor Information

>7f9h Chain B (length=68) Species: 1263550 (Edwardsiella piscicida)

SAQDWHRADIVAALHKRGITLAGLSRAHGLAARTLSNAMERHYPRAERLI
AQALDMRPEDIWPQRYRN

Ligand information

>7f9h Chain D (length=22)

cgaaatatctatagatatttcg

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7f9h Xenogeneic nucleoid-associated EnrR thwarts H-NS silencing of bacterial virulence with unique DNA binding.
• Resolution: 1.78 Å
• Binding residue (original residue number in PDB): L44 A45 R47 T48 R55 Y57 P58 R59
• Binding residue (residue number reindexed from 1): L30 A31 R33 T34 R41 Y43 P44 R45

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Nov 28 23:07:30 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7f9h', asym_id = 'B', bs = 'BS02', title = 'Xenogeneic nucleoid-associated EnrR thwarts H-NS...g of bacterial virulence with unique DNA binding.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7f9h', asym_id='B', bs='BS02', title='Xenogeneic nucleoid-associated EnrR thwarts H-NS...g of bacterial virulence with unique DNA binding.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003677', uniprot = '', pdbid = '7f9h', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677', uniprot='', pdbid='7f9h', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>