Structure of PDB 7f7i Chain B Binding Site BS02

Receptor Information
>7f7i Chain B (length=191) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FQGPGSEFVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKRE
YEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQ
GKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARK
AFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f7i Entropy of stapled peptide inhibitors in free state is the major contributor to the improvement of binding affinity with the GK domain.
Resolution2.595 Å
Binding residue
(original residue number in PDB)
S528 F530 V531 Y533 H642 H644 D710 L711 S712 G713
Binding residue
(residue number reindexed from 1)
S6 F8 V9 Y11 H120 H122 D188 L189 S190 G191
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7f7i, PDBe:7f7i, PDBj:7f7i
PDBsum7f7i
PubMed34458841
UniProtP31016|DLG4_RAT Disks large homolog 4 (Gene Name=Dlg4)

[Back to BioLiP]