Structure of PDB 7f2f Chain B Binding Site BS02

Receptor Information
>7f2f Chain B (length=94) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LTPFQKQAHNKIEKRYRININTKIARLQQIIPWVASEQTAFEVGSTKLNK
SMILEKAVDYILYLQNNERLYEMEVQRLKSEIDTLKQDQKLEHH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f2f Crystal structure of the complex of DNA with the C-terminal domain of TYE7 from Saccharomyces cerevisiae.
Resolution2.55 Å
Binding residue
(original residue number in PDB)		H185 N186 E189 R193 A216 F217 E218 N250 K251
Binding residue
(residue number reindexed from 1)		H9 N10 E13 R17 A40 F41 E42 N49 K50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:7f2f, PDBe:7f2f, PDBj:7f2f
PDBsum7f2f
PubMed
UniProtP33122|TYE7_YEAST Transcription factor TYE7 (Gene Name=TYE7)

[Back to BioLiP]