Structure of PDB 7elj Chain B Binding Site BS02

Receptor Information

>7elj Chain B (length=30) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

Ligand information

>7elj Chain C (length=4) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

VYYR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7elj Prion-derived tetrapeptide stabilizes thermolabile insulin via conformational trapping.
Resolution	N/A
Binding residue (original residue number in PDB)	V2 N3 Q4 H5 H10
Binding residue (residue number reindexed from 1)	V2 N3 Q4 H5 H10

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005179	hormone activity

	Cellular Component
GO:0005576	extracellular region

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:7elj, PDBe:7elj, PDBj:7elj
PDBsum	7elj
PubMed	34142060
UniProt	P01317\|INS_BOVIN Insulin (Gene Name=INS)

[Back to BioLiP]