Structure of PDB 7eiu Chain B Binding Site BS02

Receptor Information
>7eiu Chain B (length=147) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRNSVDYAQIASGIDTRTTVMIKNIPNKFTQQMLRDYIDVTNKGTYDFLY
LRIDFVNKCNVGYAFINFIEPQSIITFGKARVGTQWNVFHSEKICDISYA
NIQGKDRLIEKFRNSCVMDENPAYRPKIFVSHGPNRGMEEPFPAPNN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7eiu Structural insights reveal the specific recognition of meiRNA by the Mei2 protein.
Resolution2.349 Å
Binding residue
(original residue number in PDB)		N582 M600 R631 Y642 F644 S677 Y678 A679 N680 I681 K690 F691 S694 C695
Binding residue
(residue number reindexed from 1)		N3 M21 R52 Y63 F65 S98 Y99 A100 N101 I102 K111 F112 S115 C116
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:7eiu, PDBe:7eiu, PDBj:7eiu
PDBsum7eiu
PubMed35512546
UniProtP08965|MEI2_SCHPO Meiosis protein mei2 (Gene Name=mei2)

[Back to BioLiP]