Structure of PDB 7dwr Chain B Binding Site BS02

Receptor Information

>7dwr Chain B (length=220) Species: 273057 (Saccharolobus solfataricus P2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MIVTVINQKGGVGKTTTSVNLSYYLSKEKKTGLLDLDPEGGATISYGMKR
ELKELPLGEKSVNIFNVEVFPAHIGLLKLELNGDVEEISNKIKEIGKQFD
FLVIDTPPNLGTLAISAMLVADRIVSPVTPQPLALEAIKNLDSRLKSIGK
NAYSFTNFSKKVVKLDNLSSVKFTEITIPPSRLFIEASRLGVPALRYEEV
RIKKPKLANYYQQLAKVISE

Ligand information

>7dwr Chain H (length=24) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tccctgtttcacgtggaacaccct

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7dwr Chromosome segregation in Archaea: SegA- and SegB-DNA complex structures provide insights into segrosome assembly.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	K9 G11 F158
Binding residue (residue number reindexed from 1)	K9 G11 F158

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000166	nucleotide binding
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:7dwr, PDBe:7dwr, PDBj:7dwr
PDBsum	7dwr
PubMed	34850144
UniProt	Q981B3

[Back to BioLiP]