Structure of PDB 7dvv Chain B Binding Site BS02

Receptor Information
>7dvv Chain B (length=140) Species: 211110 (Streptococcus agalactiae NEM316) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENPLQKARILVNQLEKYLDRYAKEYDVEHLAGPQGHLVMHLYKHPDKDMS
IKDAEEILHISKSVASNLVKRMEKNGFIAIVPSKTDKRVKYLYLTHLGKQ
KATQFEIFLEKLHSTMLAGITKEEIRTTKKVIRTLAKNMA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dvv Heme controls the structural rearrangement of its sensor protein mediating the hemolytic bacterial survival.
Resolution2.49 Å
Binding residue
(original residue number in PDB)		P34 Q35 I61 S62 S64 V65 R72 K75 K88
Binding residue
(residue number reindexed from 1)		P33 Q34 I60 S61 S63 V64 R71 K74 K87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7dvv, PDBe:7dvv, PDBj:7dvv
PDBsum7dvv
PubMed33850260
UniProtQ8E4J9

[Back to BioLiP]