Structure of PDB 7dv2 Chain B Binding Site BS02

Receptor Information
>7dv2 Chain B (length=74) Species: 273057 (Saccharolobus solfataricus P2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEEKIKNDMLKYIEKDPKIGVWSYPAFLVLQYLYHTVPGFKMSRTAKEAL
EKGLKEMYPTLFTIAEKIAKERFK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dv2 Chromosome segregation in Archaea: SegA- and SegB-DNA complex structures provide insights into segrosome assembly.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		K52 G54 W56
Binding residue
(residue number reindexed from 1)		K18 G20 W22
Enzymatic activity
Enzyme Commision number ?
External links