Structure of PDB 7cfd Chain B Binding Site BS02

Receptor Information
>7cfd Chain B (length=178) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IGSIVGILITFINGPTEVYGQFLDGSPPLVWDKKDVPENKRTFKSKPRLL
DIVLALYSDGCFYRAQIIDEFPSEYMIFYVDYGNTEFVPLSCLAPCENVD
SFKPHRVFSFHIEGIVRSKNLTHQKTIECIEYLKSKLLNTEMNVHLVQRL
PDGFLIRFLDDWKYIPEQLLQRNYAQVS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cfd Binding of guide piRNA triggers methylation of the unstructured N-terminal region of Aub leading to assembly of the piRNA amplification complex.
Resolution2.704 Å
Binding residue
(original residue number in PDB)
L623 E653
Binding residue
(residue number reindexed from 1)
L56 E86
Enzymatic activity
Enzyme Commision number ?
External links