Structure of PDB 7ccj Chain B Binding Site BS02

Receptor Information
>7ccj Chain B (length=161) Species: 38300 (Streptomyces pristinaespiralis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TDTDRSEDFLRRVRGLKAARTANGPRLYQPITLLWAVGRARRGEARTLAW
ADTDEAIGALLKRHGARGERPRPDYPVLALHRAGLWTLEGHVGEVPTAHG
DSALRNWFAEQRPVGGLAEPFHDLLHRSGHSRVSVIEALLTTYFAGLDPV
PLLEDTGLYDE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ccj DNA backbone interactions impact the sequence specificity of DNA sulfur-binding domains: revelations from structural analyses.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		K20 A21 A22 R29 Y31 R73 Y78 P79 A82 R85 T100 A101 H102 D104
Binding residue
(residue number reindexed from 1)		K17 A18 A19 R26 Y28 R70 Y75 P76 A79 R82 T97 A98 H99 D101
Enzymatic activity
Enzyme Commision number ?
External links