Structure of PDB 7c9o Chain B Binding Site BS02

Receptor Information
>7c9o Chain B (length=85) Species: 39947 (Oryza sativa Japonica Group) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QDRFLPIANVSRIMKRSLPANAKISKEAKETVQECVSEFISFVTGEASDK
CQREKRKTINGDDLLWAMTTLGFEAYVGPLKSYLN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7c9o Structural Insight into DNA Recognition by CCT/NF-YB/YC Complexes in Plant Photoperiodic Flowering.
Resolution2.55 Å
Binding residue
(original residue number in PDB)		I65 A66 N67 R70
Binding residue
(residue number reindexed from 1)		I7 A8 N9 R12
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0043565 sequence-specific DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0016602 CCAAT-binding factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7c9o, PDBe:7c9o, PDBj:7c9o
PDBsum7c9o
PubMed32843433
UniProtQ0J7P4|HD5_ORYSJ Nuclear transcription factor Y subunit B-11 (Gene Name=HD5)

[Back to BioLiP]