Structure of PDB 7boh Chain B Binding Site BS02

Receptor Information

>7boh Chain B (length=224) Species: 83333 (Escherichia coli K-12)

VSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEA
LAELNKIASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTN
WKTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTRELEKLENSLGGIKD
MGGLPDALFVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGN
DDAIRAVTLYLGAVAATVREGRSQ

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 7boh Chain B Residue 301

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7boh A conserved rRNA switch is central to decoding site maturation on the small ribosomal subunit.
• Resolution: 2.82 Å
• Binding residue (original residue number in PDB): H18 D188 D204
• Binding residue (residue number reindexed from 1): H15 D185 D201
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0008270 zinc ion binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7boh, PDBe:7boh, PDBj:7boh
• PDBsum: 7boh
• PubMed: 34088665
• UniProt: P0A7V0|RS2_ECOLI Small ribosomal subunit protein uS2 (Gene Name=rpsB)