Structure of PDB 7bhy Chain B Binding Site BS02

Receptor Information
>7bhy Chain B (length=53) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEKQQLSIEAARLYYQSDYSQQQIAEQLNISRPTVSRLLQYAKEKGYVQI
RVM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bhy Structural insight into DNA recognition by bacterial transcriptional regulators of the SorC/DeoR family.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
Y16 Q23 R34 P35 S38
Binding residue
(residue number reindexed from 1)
Y14 Q21 R32 P33 S36
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7bhy, PDBe:7bhy, PDBj:7bhy
PDBsum7bhy
PubMed34726169
UniProtP39140|DEOR_BACSU Deoxyribonucleoside regulator (Gene Name=deoR)

[Back to BioLiP]