Structure of PDB 7bai Chain B Binding Site BS02

Receptor Information
>7bai Chain B (length=121) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPK
QFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGV
QTLYSKWKDFHFEKIPFDPAE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bai A conserved isoleucine in the RNA sensor RIG-I controls immune tolerance to mitochondrial RNA
Resolution3.4 Å
Binding residue
(original residue number in PDB)
C829 H830 K851 F853 K858 K861 G874 K888 K907
Binding residue
(residue number reindexed from 1)
C28 H29 K50 F52 K57 K60 G73 K87 K106
Enzymatic activity
Enzyme Commision number 3.6.4.13: RNA helicase.
External links
PDB RCSB:7bai, PDBe:7bai, PDBj:7bai
PDBsum7bai
PubMed
UniProtO95786|RIGI_HUMAN Antiviral innate immune response receptor RIG-I (Gene Name=RIGI)

[Back to BioLiP]