Structure of PDB 7bah Chain B Binding Site BS02

Receptor Information
>7bah Chain B (length=122) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPK
QFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGV
QTLYSKWKDFHFEKIPFDPAEM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bah A conserved isoleucine in the RNA sensor RIG-I controls immune tolerance to mitochondrial RNA
Resolution1.89 Å
Binding residue
(original residue number in PDB)
C829 H830 F853 I875 V886 K888
Binding residue
(residue number reindexed from 1)
C28 H29 F52 I74 V85 K87
Enzymatic activity
Enzyme Commision number 3.6.4.13: RNA helicase.
External links
PDB RCSB:7bah, PDBe:7bah, PDBj:7bah
PDBsum7bah
PubMed
UniProtO95786|RIGI_HUMAN Antiviral innate immune response receptor RIG-I (Gene Name=RIGI)

[Back to BioLiP]