Structure of PDB 7b1j Chain B Binding Site BS02

Receptor Information
>7b1j Chain B (length=122) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTE
NQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRR
QDSIPAFLSSLTLELFSRQTVA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7b1j Molecular mechanism of Mad1 kinetochore targeting by phosphorylated Bub1.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		S610 L613 R617 V621 F622 K625
Binding residue
(residue number reindexed from 1)		S14 L17 R21 V25 F26 K29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0007094 mitotic spindle assembly checkpoint signaling

View graph for
Biological Process
External links
PDB RCSB:7b1j, PDBe:7b1j, PDBj:7b1j
PDBsum7b1j
PubMed34013668
UniProtQ9Y6D9|MD1L1_HUMAN Mitotic spindle assembly checkpoint protein MAD1 (Gene Name=MAD1L1)

[Back to BioLiP]