Structure of PDB 7aw7 Chain B Binding Site BS02

Receptor Information
>7aw7 Chain B (length=92) Species: 227321 (Aspergillus nidulans FGSC A4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKEQDRWLPIANVARIMKLALPENAKIAKEAKECMQECVSEFISFITSEA
SEKCQQEKRKTVNGEDILFAMTSLGFENYAEALKIYLSKYRE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7aw7 Structural insights into cooperative DNA recognition by the CCAAT-binding complex and its bZIP transcription factor HapX.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		K42 Q44 K66 I67 A68 K69
Binding residue
(residue number reindexed from 1)		K2 Q4 K26 I27 A28 K29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0043565 sequence-specific DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0016602 CCAAT-binding factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7aw7, PDBe:7aw7, PDBj:7aw7
PDBsum7aw7
PubMed35472306
UniProtQ5B5Z6

[Back to BioLiP]