Structure of PDB 7amt Chain B Binding Site BS02

Receptor Information

>7amt Chain B (length=183) Species: 663 (Vibrio alginolyticus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LSPIKRKQQLMEIALEVFARRGIGRGGHADIAEIAQVSVATVFNYFPTRE
DLVDEVLNHVVRQFSNFLSDNIDLDLHARENIANITNAMIELVSQDCHWL
KVWFEWSASTRDEVWPLFVSTNRTNQLLVQNMFIKAIERGEVCHDSEHLA
NLFHGICYSLFVQANRAAELKHLVNSYLDMLCI

Ligand information

>7amt Chain F (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ataatgacattactgtatata

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7amt Binding site profiles and N-terminal minor groove interactions of the master quorum-sensing regulator LuxR enable flexible control of gene activation and repression.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	R32 F54 P58 T59 R60
Binding residue (residue number reindexed from 1)	R21 F43 P47 T48 R49

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7amt, PDBe:7amt, PDBj:7amt
PDBsum	7amt
PubMed	33693882
UniProt	B4X9Q4

[Back to BioLiP]