Structure of PDB 7amn Chain B Binding Site BS02

Receptor Information

>7amn Chain B (length=186) Species: 663 (Vibrio alginolyticus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RTRLSPIKRKQQLMEIALEVFARRGIGRGGHADIAEIAQVSVATVFNYFP
TREDLVDEVLNHVVRQFSNFLSDNIDLDLHARENIANITNAMIELVSQDC
HWLKVWFEWSASTRDEVWPLFVSTNRTNQLLVQNMFIKAIERGEVCHDSE
HLANLFHGICYSLFVQANRAAELKHLVNSYLDMLCI

Ligand information

>7amn Chain F (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttattgataattttatcaata

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7amn Binding site profiles and N-terminal minor groove interactions of the master quorum-sensing regulator LuxR enable flexible control of gene activation and repression.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	R9 F54 P58 T59 R60
Binding residue (residue number reindexed from 1)	R1 F46 P50 T51 R52

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7amn, PDBe:7amn, PDBj:7amn
PDBsum	7amn
PubMed	33693882
UniProt	B4X9Q4

[Back to BioLiP]