Structure of PDB 7ako Chain B Binding Site BS02

Receptor Information
>7ako Chain B (length=271) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SAVPFVEDWRLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPE
NIKKEICINKMLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDI
GMPEPDAQRFFHQLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFG
LATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTA
MLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLALLHKILVENP
SARITIPDIKKDRWYNKPLKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ako Structural basis for recruitment of the CHK1 DNA damage kinase by the CLASPIN scaffold protein.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		K54 C57 R129 T153 V154 R156 Y157 R160 R162 K166
Binding residue
(residue number reindexed from 1)		K54 C57 R129 T153 V154 R156 Y157 R160 R162 K166
Enzymatic activity
Catalytic site (original residue number in PDB) D130 K132 N135 D148 T170
Catalytic site (residue number reindexed from 1) D130 K132 N135 D148 T170
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0005524 ATP binding
Biological Process
GO:0000077 DNA damage checkpoint signaling
GO:0006468 protein phosphorylation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7ako, PDBe:7ako, PDBj:7ako
PDBsum7ako
PubMed33789090
UniProtO14757|CHK1_HUMAN Serine/threonine-protein kinase Chk1 (Gene Name=CHEK1)

[Back to BioLiP]