Structure of PDB 7aa7 Chain B Binding Site BS02

Receptor Information
>7aa7 Chain B (length=114) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL
VPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHE
EDYFLYVAYSDESV
Ligand information
Ligand IDSAT
InChIInChI=1S/C2H4O5S/c3-2(4)1-8(5,6)7/h1H2,(H,3,4)(H,5,6,7)
InChIKeyAGGIJOLULBJGTQ-UHFFFAOYSA-N
SMILES
SoftwareSMILES
CACTVS 3.341OC(=O)C[S](O)(=O)=O
ACDLabs 10.04O=C(O)CS(=O)(=O)O
OpenEye OEToolkits 1.5.0C(C(=O)O)S(=O)(=O)O
FormulaC2 H4 O5 S
Namesulfoacetic acid
ChEMBL
DrugBank
ZINCZINC000004429660
PDB chain7aa7 Chain B Residue 201 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7aa7 Phosphorylation of the LIR Domain of SCOC Modulates ATG8 Binding Affinity and Specificity.
Resolution1.45 Å
Binding residue
(original residue number in PDB)		Y61 F77 I84
Binding residue
(residue number reindexed from 1)		Y61 F77 I84
Annotation score1
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005543 phospholipid binding
GO:0008429 phosphatidylethanolamine binding
GO:0030957 Tat protein binding
GO:0031625 ubiquitin protein ligase binding
GO:0048487 beta-tubulin binding
GO:0050811 GABA receptor binding
Biological Process
GO:0000045 autophagosome assembly
GO:0000422 autophagy of mitochondrion
GO:0006914 autophagy
GO:0006995 cellular response to nitrogen starvation
GO:0061723 glycophagy
GO:0097352 autophagosome maturation
Cellular Component
GO:0000421 autophagosome membrane
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005776 autophagosome
GO:0005783 endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0016020 membrane
GO:0030659 cytoplasmic vesicle membrane
GO:0031410 cytoplasmic vesicle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7aa7, PDBe:7aa7, PDBj:7aa7
PDBsum7aa7
PubMed33845085
UniProtQ9H0R8|GBRL1_HUMAN Gamma-aminobutyric acid receptor-associated protein-like 1 (Gene Name=GABARAPL1)

[Back to BioLiP]