Structure of PDB 7a4y Chain B Binding Site BS02

Receptor Information
>7a4y Chain B (length=115) Species: 9844 (Lama glama) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLQESGGGLVQPGGSLRLSCAASQFTFSSDWMYWVRQAPGKGLEWVSSIS
PGGAATAYAASVKGRFTISRDNAKNTLYLQMNSLKSEDTAVYYCSKTRAG
TGRGQGTQVTVSSGR
Ligand information
>7a4y Chain E (length=29) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ENSQLEEKISQLKQKNSELKEEIQQLEYG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7a4y A nanobody toolbox targeting dimeric coiled-coil modules for functionalization of designed protein origami structures.
Resolution2.157 Å
Binding residue
(original residue number in PDB)		W33 Y35 S52 G54 A56 A57
Binding residue
(residue number reindexed from 1)		W31 Y33 S50 G52 A54 A55
External links