Structure of PDB 6z6p Chain B Binding Site BS02

Receptor Information
>6z6p Chain B (length=83) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDA
VTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>6z6p Chain J (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcgatgtatatatctgacacgtgcctggagactagggagtaatcccctt
ggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctag
agctgtctacgaccaattgagcggcctcggcaccgggattctgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6z6p Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
Resolution4.43 Å
Binding residue
(original residue number in PDB)
R35 R45 I46 S47 G48 R78 K79 T80
Binding residue
(residue number reindexed from 1)
R16 R26 I27 S28 G29 R59 K60 T61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity

View graph for
Molecular Function
External links
PDB RCSB:6z6p, PDBe:6z6p, PDBj:6z6p
PDBsum6z6p
PubMed33523989
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]