Structure of PDB 6yrq Chain B Binding Site BS02

Receptor Information
>6yrq Chain B (length=99) Species: 1980456 (Orthohantavirus andesense) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CTVFCTLAGPGASCEAYSENGIFNISSPTCLVNKVSEQKINFICQRVDQD
VVVYCNGQKKVILTKTLVIGQCIYTFTSLFSLMPDVAHSLAVELCVPGL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6yrq The Hantavirus Surface Glycoprotein Lattice and Its Fusion Control Mechanism.
Resolution1.902 Å
Binding residue
(original residue number in PDB)
P388 Q428 R429 D431
Binding residue
(residue number reindexed from 1)
P10 Q45 R46 D48
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6yrq, PDBe:6yrq, PDBj:6yrq
PDBsum6yrq
PubMed32937107
UniProtQ9E006|GP_ANDV Envelopment polyprotein (Gene Name=GP)

[Back to BioLiP]