Structure of PDB 6ycs Chain B Binding Site BS02

Receptor Information
>6ycs Chain B (length=67) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQW
SQLKEQISDIDDAVRKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ycs Origins of the Increased Affinity of Phosphorothioate-Modified Therapeutic Nucleic Acids for Proteins.
Resolution3.05 Å
Binding residue
(original residue number in PDB)		E93 K97
Binding residue
(residue number reindexed from 1)		E33 K37
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003713 transcription coactivator activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0060261 positive regulation of transcription initiation by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6ycs, PDBe:6ycs, PDBj:6ycs
PDBsum6ycs
PubMed32202774
UniProtP53999|TCP4_HUMAN Activated RNA polymerase II transcriptional coactivator p15 (Gene Name=SUB1)

[Back to BioLiP]