Structure of PDB 6y9p Chain B Binding Site BS02

Receptor Information
>6y9p Chain B (length=90) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STLVRVRKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGHV
ILEVNGQTLRGKEHKEAARIIAEAFKTKERDYIDFLVTEF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6y9p Deciphering the Unexpected Binding Capacity of the Third PDZ Domain of Whirlin to Various Cochlear Hair Cell Partners.
Resolution3.169 Å
Binding residue
(original residue number in PDB)		L825 G826 I827 A828 I829 H876 A880 I883
Binding residue
(residue number reindexed from 1)		L13 G14 I15 A16 I17 H64 A68 I71
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6y9p, PDBe:6y9p, PDBj:6y9p
PDBsum6y9p
PubMed32971111
UniProtQ80VW5|WHRN_MOUSE Whirlin (Gene Name=Whrn)

[Back to BioLiP]