Structure of PDB 6y93 Chain B Binding Site BS02

Receptor Information
>6y93 Chain B (length=116) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TASVALIENLQREELSSIEEAHAYARLLELHDLTQEALAQRLGKGQSTIA
NKLRLLKLPQPVQEAIMEKKITERHARALIPLKQPELQVTLLTEIIEKSL
NVKQTEDRVVKMLEQG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6y93 Diversification of DNA-Binding Specificity by Permissive and Specificity-Switching Mutations in the ParB/Noc Protein Family.
Resolution2.23 Å
Binding residue
(original residue number in PDB)		T146 Q147 Q158 N163 R166
Binding residue
(residue number reindexed from 1)		T34 Q35 Q46 N51 R54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6y93, PDBe:6y93, PDBj:6y93
PDBsum6y93
PubMed32698006
UniProtP37524|NOC_BACSU Nucleoid occlusion protein (Gene Name=noc)

[Back to BioLiP]