Structure of PDB 6y37 Chain B Binding Site BS02

Receptor Information
>6y37 Chain B (length=91) Species: 227321 (Aspergillus nidulans FGSC A4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KEQDRWLPIANVARIMKLALPENAKIAKEAKECMQECVSEFISFITSEAS
EKCQQEKRKTVNGEDILFAMTSLGFENYAEALKIYLSKYRE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6y37 Structural basis of HapE P88L -linked antifungal triazole resistance in Aspergillus fumigatus .
Resolution2.2 Å
Binding residue
(original residue number in PDB)		K66 I67 A68 K69 K72 K100
Binding residue
(residue number reindexed from 1)		K25 I26 A27 K28 K31 K59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0043565 sequence-specific DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0016602 CCAAT-binding factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6y37, PDBe:6y37, PDBj:6y37
PDBsum6y37
PubMed32467317
UniProtQ5B5Z6

[Back to BioLiP]