Structure of PDB 6y36 Chain B Binding Site BS02

Receptor Information
>6y36 Chain B (length=92) Species: 451804 (Aspergillus fumigatus A1163) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKEQDRWLPIANVARIMKLALPENAKIAKEAKECMQECVSEFISFITSEA
SEKCQQEKRKTVNGEDILFAMTSLGFENYAEALKIYLSKYRE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6y36 Structural basis of HapE P88L -linked antifungal triazole resistance in Aspergillus fumigatus .
Resolution2.3 Å
Binding residue
(original residue number in PDB)		K64 I65 A66 K67
Binding residue
(residue number reindexed from 1)		K26 I27 A28 K29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0043565 sequence-specific DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0016602 CCAAT-binding factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6y36, PDBe:6y36, PDBj:6y36
PDBsum6y36
PubMed32467317
UniProtA0A229Y8Y1

[Back to BioLiP]