Structure of PDB 6xnx Chain B Binding Site BS02

Receptor Information

>6xnx Chain B (length=342) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MALQMVTVGHNIALIQPGFSLMNFDGQVFFFGQKGWPKRSCPTGVFHFDI
KQNHLKLKPAIFSKDSCYLPPLRYPATCSYKKHQYIIHGGKTPNNELSDK
IYIMSVACKNNKKVTFRCTEKDLVGDVPEPRYGHSIDVVYSRGKSMGVLF
GGRSYMPSTQRTTEKWNSVADCLPHVFLIDFEFGCATSYILPELQDGLSF
HVSIARNDTVYILGGHSLASNIRPANLYRIRVDLPLGTPAVNCTVLPGGI
SVSSAILTQTNNDEFVIVGGYQLENQKRMVCSLVSLGDNTIEISEMETPD
WTSDIKHSKIWFGSNMGNGTIFLGIPGDNAMSEAFYFYTLRC

Ligand information

>6xnx Chain I (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

caggatagggctac

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6xnx Structural basis for the activation and suppression of transposition during evolution of the RAG recombinase.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	K58 K118 K119
Binding residue (residue number reindexed from 1)	K58 K112 K113

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

	Biological Process
GO:0006310	DNA recombination

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6xnx, PDBe:6xnx, PDBj:6xnx
PDBsum	6xnx
PubMed	32945578
UniProt	P21784\|RAG2_MOUSE V(D)J recombination-activating protein 2 (Gene Name=Rag2)

[Back to BioLiP]