Structure of PDB 6xkb Chain B Binding Site BS02

Receptor Information
>6xkb Chain B (length=138) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GMDAVNAFNQELFSLMDMKPPISRAKMILITKAAIKAIKLYKHVVQIVEK
FIKKCKPEYKVPGLYVIDSIVRQSRHQFGTDKDVFGPRFSKNITATFQYL
YLCPSEDKSKIVRVLNLWQKNGVFKIEIIQPLLDMAAG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xkb Structural basis for the recognition of the S2, S5-phosphorylated RNA polymerase II CTD by the mRNA anti-terminator protein hSCAF4.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		K107 A136
Binding residue
(residue number reindexed from 1)		K108 A137
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6xkb, PDBe:6xkb, PDBj:6xkb
PDBsum6xkb
PubMed34897689
UniProtO95104|SCAF4_HUMAN SR-related and CTD-associated factor 4 (Gene Name=SCAF4)

[Back to BioLiP]