Structure of PDB 6wig Chain B Binding Site BS02

Receptor Information
>6wig Chain B (length=68) Species: 3880 (Medicago truncatula) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VVSSRWNPTPEQLRALEELYRRGTRTPSAEQIQQITAQLRKFGKIEGKNV
FYWFQNHKARERQKRRRQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wig Structure of the unique tetrameric STENOFOLIA homeodomain bound with target promoter DNA.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		S95 R96 Q146 R153
Binding residue
(residue number reindexed from 1)		S4 R5 Q55 R62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0099402 plant organ development

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6wig, PDBe:6wig, PDBj:6wig
PDBsum6wig
PubMed34342278
UniProtG0ZGT3

[Back to BioLiP]