Structure of PDB 6ts3 Chain B Binding Site BS02

Receptor Information
>6ts3 Chain B (length=70) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNATDTAEQVIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSG
PGSVPGALDYAAFSSALYGE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ts3 EF-hands 3 and 4 of alpha-actinin in complex with CaMKII regulatory segment
Resolution1.28 Å
Binding residue
(original residue number in PDB)
Q830 S834 F835 Q858 Y861 L888 Y889
Binding residue
(residue number reindexed from 1)
Q9 S13 F14 Q37 Y40 L67 Y68
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6ts3, PDBe:6ts3, PDBj:6ts3
PDBsum6ts3
PubMed
UniProtP35609|ACTN2_HUMAN Alpha-actinin-2 (Gene Name=ACTN2)

[Back to BioLiP]