Structure of PDB 6t22 Chain B Binding Site BS02

Receptor Information
>6t22 Chain B (length=145) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EFMHVFDNNGIELKAECSIGEEDGVYGLILESWGPGDRNKDYNIALDYII
ERLVDSGVSQVVVYLASSSVRKHMHSLDERKIHPGEYFTLIGNSPRDIRL
KMCGYQAYFSRTGRKEIPSGNRTKRILINVPGIYSDSFWASIIRG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6t22 Crystal structure of the EcoKMcrA N-terminal domain (NEco): recognition of modified cytosine bases without flipping.
Resolution2.21 Å
Binding residue
(original residue number in PDB)
W31 P33 G34 R97 L98 R120
Binding residue
(residue number reindexed from 1)
W33 P35 G36 R99 L100 R122
Enzymatic activity
Enzyme Commision number 3.1.21.-
External links
PDB RCSB:6t22, PDBe:6t22, PDBj:6t22
PDBsum6t22
PubMed31724709
UniProtP24200|MCRA_ECOLI Type IV methyl-directed restriction enzyme EcoKMcrA (Gene Name=mcrA)

[Back to BioLiP]