Structure of PDB 6sy0 Chain B Binding Site BS02

Receptor Information
>6sy0 Chain B (length=132) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QEPVILIDKIERCLVVEWYENNIRREQRISYKKYGNDKAKLRAKELIEKL
KSGITFEQLYPDKGPPIVRVFENVGVYNVSLIRDRIEREWRVEWLENGVP
MKARWSCKKVGNDEAQKRADTFAQSMIKGIFN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sy0 Structural and functional analysis of the Plasmodium falciparum SIP2 DNA binding domain
Resolution3.102 Å
Binding residue
(original residue number in PDB)
K39 K40 K115 K116
Binding residue
(residue number reindexed from 1)
K32 K33 K108 K109
Enzymatic activity
Enzyme Commision number ?
External links