Structure of PDB 6s0y Chain B Binding Site BS02

Receptor Information
>6s0y Chain B (length=119) Species: 9844 (Lama glama) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLQESGGGLVQTGGSLRLSCAFSGSDDYVIGWFRQAPGKGRQGVSCIRL
SGGGTIYADSAKGRFTVSADNAKKTVYLQMTRLKPEDTAVYYCGAERYNV
EGCGYDVAYWGKGTQVTVS
Ligand information
>6s0y Chain D (length=13) Species: 526896 (Influenza A virus (A/Jeju/2279/2007(H1N1))) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VETPIRNEWGCRC
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6s0y Selective Engagement of Fc gamma RIV by a M2e-Specific Single Domain Antibody Construct Protects Against Influenza A Virus Infection.
Resolution1.81 Å
Binding residue
(original residue number in PDB)		F37 R45 Q46 G47 Y60 V103 E104 G105 C106 G107 Y108 W113
Binding residue
(residue number reindexed from 1)		F34 R42 Q43 G44 Y57 V100 E101 G102 C103 G104 Y105 W110
External links