Structure of PDB 6r16 Chain B Binding Site BS02

Receptor Information
>6r16 Chain B (length=194) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TEAQARAIVNSALKLYSQDKTGMVDFALESGGGSILSTRCSETYETKTAL
MSLFGIPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMMIHPAA
FTLEHIPKTLSPTGNISSAPKDFAVYGLENEYQEEGQLLGQFTYDQDGES
LQMFQALKRPDDTAFQIVELRIFSNWGHPEYTCLYRFRVHGEPV
Ligand information
>6r16 Chain J (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GGPCCSHARIPRTPYLVLSYVNGLPPV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6r16 A molecular mechanism for LINC complex branching by structurally diverse SUN-KASH 6:6 assemblies.
Resolution2.75 Å
Binding residue
(original residue number in PDB)		T665 A666 L667 M668 S669 L670 F671 S735 Y798 C800 Y802
Binding residue
(residue number reindexed from 1)		T48 A49 L50 M51 S52 L53 F54 S118 Y181 C183 Y185
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6r16, PDBe:6r16, PDBj:6r16
PDBsum6r16
PubMed33393904
UniProtO94901|SUN1_HUMAN SUN domain-containing protein 1 (Gene Name=SUN1)

[Back to BioLiP]