Structure of PDB 6qua Chain B Binding Site BS02

Receptor Information
>6qua Chain B (length=116) Species: 64091 (Halobacterium salinarum NRC-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PDARSDARDLTAFQKNILTVLGEEARYGLAIKRELEEYYGEEVNHGRLYP
NLDDLVNKGLVEKSELDKRTNEYALTNEGFDAVVDDLEWTLSKFVADADR
RERVETIVADDAAALE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qua Specificity of protein-DNA interactions in hypersaline environment: structural studies on complexes of Halobacterium salinarum oxidative stress-dependent protein hsRosR.
Resolution2.681 Å
Binding residue
(original residue number in PDB)
G51 R52 N56
Binding residue
(residue number reindexed from 1)
G46 R47 N51
Binding affinityPDBbind-CN: Kd=177.55nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:6qua, PDBe:6qua, PDBj:6qua
PDBsum6qua
PubMed31310308
UniProtQ9HSF4

[Back to BioLiP]