Structure of PDB 6qil Chain B Binding Site BS02

Receptor Information
>6qil Chain B (length=116) Species: 64091 (Halobacterium salinarum NRC-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PDARSDARDLTAFQKNILTVLGEEARYGLAIKRELEEYYGEEVNHGRLYP
NLDDLVNKGLVEKSELDKRTNEYALTNEGFDAVVDDLEWTLSKFVADADR
RERVETIVADDAAALE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qil Specificity of protein-DNA interactions in hypersaline environment: structural studies on complexes of Halobacterium salinarum oxidative stress-dependent protein hsRosR.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		Y32 G33 L34 H50 G51 Y54 K68 R74 T75 N76
Binding residue
(residue number reindexed from 1)		Y27 G28 L29 H45 G46 Y49 K63 R69 T70 N71
Binding affinityPDBbind-CN: Kd=49.32nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:6qil, PDBe:6qil, PDBj:6qil
PDBsum6qil
PubMed31310308
UniProtQ9HSF4

[Back to BioLiP]