Structure of PDB 6qh9 Chain B Binding Site BS02

Receptor Information
>6qh9 Chain B (length=221) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTAAHCKKPNLQVF
LGKHNLGQQESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSEL
IQPLPLERDCSAQTTSCHILGWGKTADGDFPDTIQCAYIHLVSREECEHA
YPGQITQNMLCAGDEKYGKDSCQGDSGGPLVCGDHLRGLVSWGNIPCGSK
EKPGVYTNVCRYTNWIQKTIQ
Ligand information
Ligand IDJ3B
InChIInChI=1S/C13H16N4O2/c14-11(15)8-3-5-9(6-4-8)17-13(19)10-2-1-7-16-12(10)18/h3-6,10H,1-2,7H2,(H3,14,15)(H,16,18)(H,17,19)/t10-/m1/s1
InChIKeyIZWNURHHAQZXMJ-SNVBAGLBSA-N
SMILES
SoftwareSMILES
CACTVS 3.385NC(=N)c1ccc(NC(=O)[C@@H]2CCCNC2=O)cc1
CACTVS 3.385NC(=N)c1ccc(NC(=O)[CH]2CCCNC2=O)cc1
OpenEye OEToolkits 2.0.6c1cc(ccc1C(=N)N)NC(=O)C2CCCNC2=O
OpenEye OEToolkits 2.0.6[H]/N=C(/c1ccc(cc1)NC(=O)[C@@H]2CCCNC2=O)\N
FormulaC13 H16 N4 O2
Name(3~{R})-~{N}-(4-carbamimidoylphenyl)-2-oxidanylidene-piperidine-3-carboxamide
ChEMBL
DrugBank
ZINC
PDB chain6qh9 Chain B Residue 303 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qh9 Kallikrein 5 inhibitors identified through structure based drug design in search for a treatment for Netherton Syndrome.
Resolution2.27 Å
Binding residue
(original residue number in PDB)
C42 H57 D189 S190 G193 S195 V213 W215 G216
Binding residue
(residue number reindexed from 1)
C26 H41 D170 S171 G174 S176 V190 W192 G193
Annotation score1
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 Q192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1) H41 D85 Q173 G174 D175 S176 G177
Enzyme Commision number 3.4.21.-
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005515 protein binding
GO:0008233 peptidase activity
GO:0008236 serine-type peptidase activity
Biological Process
GO:0006508 proteolysis
GO:0007417 central nervous system development
GO:0009611 response to wounding
GO:0010975 regulation of neuron projection development
GO:0016540 protein autoprocessing
GO:0030574 collagen catabolic process
GO:0042246 tissue regeneration
GO:0042445 hormone metabolic process
GO:0042552 myelination
GO:0042982 amyloid precursor protein metabolic process
GO:0045595 regulation of cell differentiation
GO:0045745 positive regulation of G protein-coupled receptor signaling pathway
Cellular Component
GO:0001533 cornified envelope
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005783 endoplasmic reticulum
GO:0030141 secretory granule
GO:0031965 nuclear membrane
GO:0045171 intercellular bridge

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6qh9, PDBe:6qh9, PDBj:6qh9
PDBsum6qh9
PubMed30691925
UniProtQ92876|KLK6_HUMAN Kallikrein-6 (Gene Name=KLK6)

[Back to BioLiP]