Structure of PDB 6qfd Chain B Binding Site BS02

Receptor Information
>6qfd Chain B (length=116) Species: 64091 (Halobacterium salinarum NRC-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PDARSDARDLTAFQKNILTVLGEEARYGLAIKRELEEYYGEEVNHGRLYP
NLDDLVNKGLVEKSELDKRTNEYALTNEGFDAVVDDLEWTLSKFVADADR
RERVETIVADDAAALE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qfd Specificity of protein-DNA interactions in hypersaline environment: structural studies on complexes of Halobacterium salinarum oxidative stress-dependent protein hsRosR.
Resolution2.133 Å
Binding residue
(original residue number in PDB)		H50 G51 R52 N56 D72 K73 R74
Binding residue
(residue number reindexed from 1)		H45 G46 R47 N51 D67 K68 R69
Binding affinityPDBbind-CN: Kd=91.59nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:6qfd, PDBe:6qfd, PDBj:6qfd
PDBsum6qfd
PubMed31310308
UniProtQ9HSF4

[Back to BioLiP]