Structure of PDB 6pka Chain B Binding Site BS02

Receptor Information
>6pka Chain B (length=180) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IPTVIYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYL
YINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKR
FALPNAEVMIHQPLGGAQGQATEIEIAANHILKTREKLNRILSERTGQSI
EKIQKDTDRDNFLTAEEAKEYGLIDEVMVP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6pka Ureadepsipeptides as ClpP Activators.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		D27 I29 Y61 Y63 Q89 M190
Binding residue
(residue number reindexed from 1)		D15 I17 Y49 Y51 Q77 M178
Enzymatic activity
Catalytic site (original residue number in PDB) G69 S98 M99 H123 D172
Catalytic site (residue number reindexed from 1) G57 S86 M87 H111 D160
Enzyme Commision number 3.4.21.92: endopeptidase Clp.
Gene Ontology
Molecular Function
GO:0004176 ATP-dependent peptidase activity
GO:0004252 serine-type endopeptidase activity
GO:0008236 serine-type peptidase activity
GO:0051117 ATPase binding
Biological Process
GO:0006508 proteolysis
GO:0006515 protein quality control for misfolded or incompletely synthesized proteins
Cellular Component
GO:0005737 cytoplasm
GO:0009368 endopeptidase Clp complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6pka, PDBe:6pka, PDBj:6pka
PDBsum6pka
PubMed31588734
UniProtQ2G036|CLPP_STAA8 ATP-dependent Clp protease proteolytic subunit (Gene Name=clpP)

[Back to BioLiP]