Structure of PDB 6pep Chain B Binding Site BS02

Receptor Information
>6pep Chain B (length=144) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KIPVTGSGFVAKDDSLRTFFDAMALQLKEPVIVSKMAARKKITGNFEFHD
PNALLEKLSLQLGLIWYFDGQAIYIYDASEMRNAVVSLRNVSLNEFNNFL
KRSGLYNKNYPLRGDNRKGTFYVSGPPVYVDMVVNAATMMDKQN
Ligand information
>6pep Chain Z (length=28) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WLKGRSFQYGAEGYIKMSPGHWYFPSPL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6pep T3S injectisome needle complex structures in four distinct states reveal the basis of membrane coupling and assembly.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		P29 N71 F72 E73 H75 L80 K83
Binding residue
(residue number reindexed from 1)		P3 N45 F46 E47 H49 L54 K57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0009306 protein secretion

View graph for
Biological Process
External links
PDB RCSB:6pep, PDBe:6pep, PDBj:6pep
PDBsum6pep
PubMed31427728
UniProtP35672|SCTC1_SALTY SPI-1 type 3 secretion system secretin (Gene Name=sctC1)

[Back to BioLiP]