Structure of PDB 6ozs Chain B Binding Site BS02

Receptor Information
>6ozs Chain B (length=244) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPPEETLSLWKGEQARLKARVVDRDTEAWQRDPSFSGLQKVGGVDVSFVK
GDSVRACASLVVLSYPELKVVYEDSRMVGLKAPYVSGFLAFREVPFLVEL
VQRLQEKEPDLMPQVVLVDGNGVLHQRGFGVACHLGVLTELPCIGVAKKL
LQVDGLENNALHKEKIVLLQAGGDTFPLIGSSGTVLGMALRSHDHSTKPL
YVSVGHRISLEVAVRLTHHCCRFRIPEPIRQADIRSREYIRRTL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ozs Evolution of Inosine-Specific Endonuclease V from Bacterial DNase to Eukaryotic RNase.
Resolution2.41 Å
Binding residue
(original residue number in PDB)		Y91 S93 G94 L96 E100 D126 N128 H132 G137 V138 K155 K156 L158 Q159
Binding residue
(residue number reindexed from 1)		Y84 S86 G87 L89 E93 D119 N121 H125 G130 V131 K148 K149 L151 Q152
Enzymatic activity
Enzyme Commision number 3.1.26.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006281 DNA repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6ozs, PDBe:6ozs, PDBj:6ozs
PDBsum6ozs
PubMed31444105
UniProtQ8C9A2|ENDOV_MOUSE Endonuclease V (Gene Name=Endov)

[Back to BioLiP]