Structure of PDB 6ozk Chain B Binding Site BS02

Receptor Information
>6ozk Chain B (length=246) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AERPPEETLSLWKGEQARLKARVVDRDTEAWQRDPSFSGLQKVGGVDVSF
VKGDSVRACASLVVLSYPELKVVYEDSRMVGLKAPYVSGFLAFREVPFLV
ELVQRLQEKEPDLMPQVVLVDGNGVLHQRGFGVACHLGVLTELPCIGVAK
KLLQVDGLENNALHKEKIVLLQAGGDTFPLIGSSGTVLGMALRSHDHSTK
PLYVSVGHRISLEVAVRLTHHCCRFRIPEPIRQADIRSREYIRRTA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ozk Evolution of Inosine-Specific Endonuclease V from Bacterial DNase to Eukaryotic RNase.
Resolution2.104 Å
Binding residue
(original residue number in PDB)		S54 F55 K57 Y91 S93 G94 L96 D126 N128 H132 G137 V138 K155 K156 L157
Binding residue
(residue number reindexed from 1)		S49 F50 K52 Y86 S88 G89 L91 D121 N123 H127 G132 V133 K150 K151 L152
Enzymatic activity
Enzyme Commision number 3.1.26.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006281 DNA repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6ozk, PDBe:6ozk, PDBj:6ozk
PDBsum6ozk
PubMed31444105
UniProtQ8C9A2|ENDOV_MOUSE Endonuclease V (Gene Name=Endov)

[Back to BioLiP]