Structure of PDB 6ozj Chain B Binding Site BS02

Receptor Information
>6ozj Chain B (length=250) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TAAERPPEETLSLWKGEQARLKARVVDRDTEAWQRDPSFSGLQKVGGVDV
SFVKGDSVRACASLVVLSYPELKVVYEDSRMVGLKAPYVSGFLAFREVPF
LVELVQRLQEKEPDLMPQVVLVDGNGVLHQRGFGVACHLGVLTELPCIGV
AKKLLQVDGLENNALHKEKIVLLQAGGDTFPLIGSSGTVLGMALRSHDHS
TKPLYVSVGHRISLEVAVRLTHHCCRFRIPEPIRQADIRSREYIRRTLGQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ozj Evolution of Inosine-Specific Endonuclease V from Bacterial DNase to Eukaryotic RNase.
Resolution2.247 Å
Binding residue
(original residue number in PDB)		V53 S54 F55 K57 Y91 S93 G94 L96 D126 N128 H132 G137 V138 A154 K155 K156 L158 Q159 R244
Binding residue
(residue number reindexed from 1)		V50 S51 F52 K54 Y88 S90 G91 L93 D123 N125 H129 G134 V135 A151 K152 K153 L155 Q156 R241
Enzymatic activity
Enzyme Commision number 3.1.26.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006281 DNA repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6ozj, PDBe:6ozj, PDBj:6ozj
PDBsum6ozj
PubMed31444105
UniProtQ8C9A2|ENDOV_MOUSE Endonuclease V (Gene Name=Endov)

[Back to BioLiP]