Structure of PDB 6od0 Chain B Binding Site BS02

Receptor Information
>6od0 Chain B (length=161) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSLPELKANPFK
ERICRVFSTSPAKDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDD
GTLNREDLSRLVNCLTGEGTRLSASEMKQLIDNILEESDIDRDGTINLSE
FQHVISRSPDF
Ligand information
Ligand IDCA
InChIInChI=1S/Ca/q+2
InChIKeyBHPQYMZQTOCNFJ-UHFFFAOYSA-N
SMILES
SoftwareSMILES
CACTVS 3.341[Ca++]
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Ca+2]
FormulaCa
NameCALCIUM ION
ChEMBL
DrugBankDB14577
ZINC
PDB chain6od0 Chain B Residue 201 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6od0 Discovery and Characterization of Peptide Inhibitors for Calcium and Integrin Binding Protein 1.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		D116 D118 D120 T122 D127
Binding residue
(residue number reindexed from 1)		D96 D98 D100 T102 D107
Annotation score4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008427 calcium-dependent protein kinase inhibitor activity
GO:0030291 protein serine/threonine kinase inhibitor activity
GO:0031267 small GTPase binding
GO:0043495 protein-membrane adaptor activity
GO:0044325 transmembrane transporter binding
GO:0046872 metal ion binding
Biological Process
GO:0001525 angiogenesis
GO:0001933 negative regulation of protein phosphorylation
GO:0001934 positive regulation of protein phosphorylation
GO:0001954 positive regulation of cell-matrix adhesion
GO:0002931 response to ischemia
GO:0006302 double-strand break repair
GO:0006915 apoptotic process
GO:0006974 DNA damage response
GO:0007026 negative regulation of microtubule depolymerization
GO:0007113 endomitotic cell cycle
GO:0007155 cell adhesion
GO:0007283 spermatogenesis
GO:0007286 spermatid development
GO:0008284 positive regulation of cell population proliferation
GO:0008285 negative regulation of cell population proliferation
GO:0010977 negative regulation of neuron projection development
GO:0030154 cell differentiation
GO:0030220 platelet formation
GO:0030307 positive regulation of cell growth
GO:0030335 positive regulation of cell migration
GO:0031122 cytoplasmic microtubule organization
GO:0033630 positive regulation of cell adhesion mediated by integrin
GO:0038163 thrombopoietin-mediated signaling pathway
GO:0042127 regulation of cell population proliferation
GO:0043066 negative regulation of apoptotic process
GO:0043085 positive regulation of catalytic activity
GO:0045653 negative regulation of megakaryocyte differentiation
GO:0051092 positive regulation of NF-kappaB transcription factor activity
GO:0051301 cell division
GO:0051302 regulation of cell division
GO:0051898 negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0070886 positive regulation of calcineurin-NFAT signaling cascade
GO:0071356 cellular response to tumor necrosis factor
GO:0071363 cellular response to growth factor stimulus
GO:0071902 positive regulation of protein serine/threonine kinase activity
GO:0090050 positive regulation of cell migration involved in sprouting angiogenesis
GO:0090314 positive regulation of protein targeting to membrane
GO:0097191 extrinsic apoptotic signaling pathway
GO:1900026 positive regulation of substrate adhesion-dependent cell spreading
GO:1903078 positive regulation of protein localization to plasma membrane
GO:1990090 cellular response to nerve growth factor stimulus
GO:2000256 positive regulation of male germ cell proliferation
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005813 centrosome
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0016324 apical plasma membrane
GO:0030027 lamellipodium
GO:0030424 axon
GO:0030426 growth cone
GO:0031982 vesicle
GO:0032433 filopodium tip
GO:0032587 ruffle membrane
GO:0042383 sarcolemma
GO:0042995 cell projection
GO:0043005 neuron projection
GO:0043025 neuronal cell body
GO:0043204 perikaryon
GO:0048471 perinuclear region of cytoplasm
GO:0070062 extracellular exosome
GO:0071944 cell periphery

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6od0, PDBe:6od0, PDBj:6od0
PDBsum6od0
PubMed32383857
UniProtQ99828|CIB1_HUMAN Calcium and integrin-binding protein 1 (Gene Name=CIB1)

[Back to BioLiP]