Structure of PDB 6o3w Chain B Binding Site BS02

Receptor Information
>6o3w Chain B (length=140) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DFQNFVATLESFKDLKSGISGSRIKKLTTYALDHIDIESKIISLIIDYSR
LCPDSHKLGSLYIIDSIGRAYLDETRSNNKPGTCAHAINTLGEVIQELLS
DAIAKSNQDHKEKIRMLLDIWDRSGLFQKSYLNAIRSKCF
Ligand information
>6o3w Chain D (length=11) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DDYKLPMEYIT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6o3w Identification of Three Sequence Motifs in the Transcription Termination Factor Sen1 that Mediate Direct Interactions with Nrd1.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		S25 G26 S27 I29 Y67 D70 S71 R74 R133 S134
Binding residue
(residue number reindexed from 1)		S20 G21 S22 I24 Y62 D65 S66 R69 R123 S124
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6o3w, PDBe:6o3w, PDBj:6o3w
PDBsum6o3w
PubMed31104813
UniProtP53617|NRD1_YEAST Protein NRD1 (Gene Name=NRD1)

[Back to BioLiP]