Structure of PDB 6o3t Chain B Binding Site BS02

Receptor Information
>6o3t Chain B (length=65) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PPYSYIALITMAIQNKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLS
LNECFVKVPGSYWTL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6o3t Crystal Structure of FOXC2 in Complex with DNA Target.
Resolution3.06 Å
Binding residue
(original residue number in PDB)		L95 R121 H122 S125 K132 G143 S144
Binding residue
(residue number reindexed from 1)		L20 R46 H47 S50 K57 G60 S61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6o3t, PDBe:6o3t, PDBj:6o3t
PDBsum6o3t
PubMed31460188
UniProtQ99958|FOXC2_HUMAN Forkhead box protein C2 (Gene Name=FOXC2)

[Back to BioLiP]